PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv8_200210_uzdz.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 733aa    MW: 80271 Da    PI: 5.8651
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv8_200210_uzdz.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.8e-1961116156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++e+e++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R+++k
  Bv8_200210_uzdz.t1  61 KKRYHRHTQHQIQEMENFFKECPHPDDKQRKELSRRLSLEPLQVKFWFQNKRTQMK 116
                         688999***********************************************998 PP

2START214.83.1e-672534731206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela +a++el+++a+a+ep+Wv s+    e++n++e+ ++ + + +      ++ea+r+s vv+m++++lve+l+d++ qW+  +     +
  Bv8_200210_uzdz.t1 253 ELAVAAMEELIRMAQAGEPLWVPSPdnmtEILNEEEYFRTSSHGIGpmplgLKSEASRDSCVVIMNHMNLVEILMDVN-QWSCVFSgivsR 342
                         57899************************************99988********************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a+tl+v+s+g      galq+m+ae+q++splvp R+ +fvRy++q+g+ +w++vdvS+d  ++ p    + R++++pSg+li++++ng+s
  Bv8_200210_uzdz.t1 343 AMTLDVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQHGDSTWAVVDVSLDGLRPSP----IPRCRRRPSGCLIQELPNGYS 429
                         ****************************************************************99....6******************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kv wvehv++++r +h+++r lv+sgla+gak+wv+tl+rqce+
  Bv8_200210_uzdz.t1 430 KVMWVEHVEVDDRAVHNIYRALVNSGLAFGAKRWVSTLDRQCER 473
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-1948118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-2049116IPR009057Homeodomain-like
PROSITE profilePS5007116.60158118IPR001356Homeobox domain
SMARTSM003899.0E-1859122IPR001356Homeobox domain
CDDcd000862.48E-1861119No hitNo description
PfamPF000465.0E-1761116IPR001356Homeobox domain
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
SuperFamilySSF559618.93E-36244475No hitNo description
PROSITE profilePS5084843.642244476IPR002913START domain
CDDcd088754.58E-126248472No hitNo description
SMARTSM002341.4E-68253473IPR002913START domain
PfamPF018521.9E-55254473IPR002913START domain
Gene3DG3DSA:3.30.530.208.4E-5349473IPR023393START-like domain
SuperFamilySSF559614.08E-26493725No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MFQPNMFETH HQLLDMAAGH KTPDSELGKM RDDEFESSRS ATENLEGLSG DDQDPNQRPK  60
KKRYHRHTQH QIQEMENFFK ECPHPDDKQR KELSRRLSLE PLQVKFWFQN KRTQMKAQHE  120
RSENQQLRSE NDKLRADNIR FKEALSNATC PNCGGPAAIG EMSFDEQQLR IENARLREEI  180
DRISGIAAKY VGKPLVTYPH LQNQGLQSRS SLDLGVGSFG PQSGMVGDIY GSAGDLLRSV  240
APPTDADKPM IIELAVAAME ELIRMAQAGE PLWVPSPDNM TEILNEEEYF RTSSHGIGPM  300
PLGLKSEASR DSCVVIMNHM NLVEILMDVN QWSCVFSGIV SRAMTLDVLS TGVAGNYNGA  360
LQVMTAEFQV PSPLVPTREN YFVRYCKQHG DSTWAVVDVS LDGLRPSPIP RCRRRPSGCL  420
IQELPNGYSK VMWVEHVEVD DRAVHNIYRA LVNSGLAFGA KRWVSTLDRQ CERLASVMAS  480
NMPAGEGGVI TSPEGRKSML KLAERMVMSF CAGVGASTAH TWTTLSGSGA DDVRVMTRKS  540
MDDPGRPPGI VLSAATSFWM PVSPKRVFDF LRDENSRSEW DILSNGGLVQ EMAHIANGRD  600
PGNCVSLLRV NSANSSQSNM LILQESSTDS TGSYVIYAPV DIVAMNVVLN GGDPDYVALL  660
PSGFAILPDG PVAGHGGGGM EVGSGGSLLT VAFQILVDSV PTAKLSLGSV ATVNSLIKCT  720
VERIKAAVAC ESA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4839512e-34AM483951.2 Vitis vinifera contig VV78X162089.20, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010665524.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_010665525.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A0J8B6V00.0A0A0J8B6V0_BETVU; Uncharacterized protein
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein